PDB entry 1qwu

View 1qwu on RCSB PDB site
Description: Golgi alpha-mannosidase II D341N mutant complex with 5-F-guloside
Class: hydrolase
Keywords: glycosyl hydrolase family 38, covalent catalytic intermediate
Deposited on 2003-09-03, released 2003-10-07
The last revision prior to the SCOP 1.73 freeze date was dated 2004-01-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.151
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-mannosidase II
    Species: Drosophila melanogaster
    Gene: ALPHA-MAN-II OR GMII OR CG18474/CG18802/CG8139
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24451
      • engineered (340)
      • see remark 999 (906)
    Domains in SCOP 1.73: d1qwua1, d1qwua2, d1qwua3
  • Heterogens: NAG, ZN, GUL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qwuA (A:)
    rsshhhhhhgefddpirpplkvarsprpgqcqdvvqdvpnvdvqmlelydrmsfkdidgg
    vwkqgwnikydplkynahhklkvfvvphshndpgwiqtfeeyyqhdtkhilsnalrhlhd
    npemkfiwaeisyfarfyhdlgenkklqmksivkngqlefvtggwvmpdeanshwrnvll
    qltegqtwlkqfmnvtptaswaidpfghsptmpyilqksgfknmliqrthysvkkelaqq
    rqleflwrqiwdnkgdtalfthmmpfysydiphtcgpdpkvccqfdfkrmgsfglscpwk
    vpprtisdqnvaarsdllvdqwkkkaelyrtnvlliplgdnfrfkqntewdvqrvnyerl
    fehinsqahfnvqaqfgtlqeyfdavhqaeragqaefptlsgdfftyadrsdnywsgyyt
    srpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhhdgitgtakt
    hvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfsyftlddsrwpgsgvedsr
    ttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtdlannpveaqvspvwswhh
    dtltktihpqgsttkyriifkarvppmglatyvltisdskpehtsyasnlllrknptslp
    lgqypedvkfgdpreislrvgngptlafseqgllksiqltqdsphvpvhfkflkygvrsh
    gdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglpsvvhqtimrggapeirnlv
    digsldnteivmrlethidsgdifytdlnglqfikrrrldklplqanyypipsgmfieda
    ntrltlltgqplggsslasgeleimqdrrlasdderglgqgvldnkpvlhiyrlvlekvn
    ncvrpsklhpagyltsaahkasqslldpldkfifaenewigaqgqfggdhpsaredldvs
    vmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchllpnvarcerttltflqnl
    ehldgmvapevcpmetaayvsshss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qwuA (A:)
    cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
    ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
    sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
    tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
    iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
    tnvlliplgdnfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
    ragqaefptlsgdfftyadrsdnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdg
    marieerleqarrelslfqhhdgitgtakthvvvdyeqrmqealkacqmvmqqsvyrllt
    kpsiyspdfsfsyftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvd
    fyvsspfvsvtdlannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmgla
    tyvltisdskpehtsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafse
    qgllksiqltqdsphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkg
    klessvsvglpsvvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlng
    lqfikrrrldklplqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrl
    asdderglgqgvldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpld
    kfifaenewigaqgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtp
    eehtqkldvchllpnvarcerttltflqnlehldgmvapevcpmetaayvsshs