PDB entry 1qwt

View 1qwt on RCSB PDB site
Description: Auto-inhibitory interferon regulation factor-3 (IRF3) transactivation domain
Class: DNA binding protein
Keywords: DNA binding protein
Deposited on 2003-09-03, released 2003-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qwta_
  • Chain 'B':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qwtb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qwtA (A:)
    spsldnptpfpnlgpsenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgse
    vgdrtlpgwpvtlpdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchty
    wavseellpnsghgpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgesw
    pqdqpwtkrlvmvkvvptclralvemarvggasslentvdlhisnshplsltsdqykayl
    qdlvegmdfqgpges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qwtA (A:)
    enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
    gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
    gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
    ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpges
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qwtB (B:)
    spsldnptpfpnlgpsenplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgse
    vgdrtlpgwpvtlpdpgmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchty
    wavseellpnsghgpdgevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgesw
    pqdqpwtkrlvmvkvvptclralvemarvggasslentvdlhisnshplsltsdqykayl
    qdlvegmdfqgpges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qwtB (B:)
    enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
    gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
    gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
    ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfqgpges