PDB entry 1qwq

View 1qwq on RCSB PDB site
Description: Solution structure of the monomeric N67D mutant of Bovine Seminal Ribonuclease
Class: Hydrolase
Keywords: ALPHA-BETA-PROTEIN, Hydrolase
Deposited on 2003-09-03, released 2003-09-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Bos taurus [TaxId:9913]
    Gene: SRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
      • engineered (66)
    Domains in SCOPe 2.05: d1qwqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qwqA (A:)
    kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv