PDB entry 1qwq

View 1qwq on RCSB PDB site
Description: Solution structure of the monomeric N67D mutant of Bovine Seminal Ribonuclease
Class: Hydrolase
Keywords: ALPHA-BETA-PROTEIN, Hydrolase
Deposited on 2003-09-03, released 2003-09-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease
  Species: Bos taurus [TaxId:9913]
  Gene: SRN
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00669 (0-123)
    • engineered (66)
  Domains in SCOPe 2.01: d1qwqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qwqA (A:)
  kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
  kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
  dasv