PDB entry 1qwo

View 1qwo on RCSB PDB site
Description: Crystal structure of a phosphorylated phytase from Aspergillus fumigatus, revealing the structural basis for its heat resilience and catalytic pathway
Class: hydrolase
Keywords: Alpha Barrel, Beta Sandwich, Orthogonal Bundle, Glycoprotein, phosphohistidine, HYDROLASE
Deposited on 2003-09-03, released 2004-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.162
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phytase
    Species: Aspergillus fumigatus [TaxId:5085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qwoa_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qwoA (A:)
    sagskscdtvdlgyqcspatshlwgqyspffsledelsvssklpkdcritlvqvlsrhga
    ryptsskskkykklvtaiqanatdfkgkfaflktynytlgaddltpfgeqqlvnsgikfy
    qrykalarsvvpfirasgsdrviasgekfiegfqqakladpgatnraapaisviipeset
    fnntldhgvctkfeasqlgdevaanftalfapdiraraekhlpgvtltdedvvslmdmcs
    fdtvartsdasqlspfcqlfthnewkkynylqslgkyygygagnplgpaqgigftnelia
    rltrspvqdhtstnstlvsnpatfplnatmyvdfshdnsmvsiffalglyngteplsrts
    vesakeldgysaswvvpfgarayfetmqcksekeplvralindrvvplhgcdvdklgrck
    lndfvkglswarsggnwgecfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qwoA (A:)
    cdtvdlgyqcspatshlwgqyspffsledelsvssklpkdcritlvqvlsrhgaryptss
    kskkykklvtaiqanatdfkgkfaflktynytlgaddltpfgeqqlvnsgikfyqrykal
    arsvvpfirasgsdrviasgekfiegfqqakladpgatnraapaisviipesetfnntld
    hgvctkfeasqlgdevaanftalfapdiraraekhlpgvtltdedvvslmdmcsfdtvar
    tsdasqlspfcqlfthnewkkynylqslgkyygygagnplgpaqgigftneliarltrsp
    vqdhtstnstlvsnpatfplnatmyvdfshdnsmvsiffalglyngteplsrtsvesake
    ldgysaswvvpfgarayfetmqcksekeplvralindrvvplhgcdvdklgrcklndfvk
    glswarsggnwgecf