PDB entry 1qwm

View 1qwm on RCSB PDB site
Description: Structure of Helicobacter pylori catalase with formic acid bound
Class: oxidoreductase
Keywords: beta barrel, azide complex, formate complex, OXIDOREDUCTASE
Deposited on 2003-09-02, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.196
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KatA Catalase
    Species: Helicobacter pylori [TaxId:210]
    Gene: katA (hp0875)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qwma_
  • Chain 'B':
    Compound: KatA Catalase
    Species: Helicobacter pylori [TaxId:210]
    Gene: katA (hp0875)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qwmb_
  • Heterogens: AZI, HEM, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qwmA (A:)
    mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
    gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
    egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
    msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
    snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
    knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
    cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
    ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
    kalekhqkmmkdmhgkdmhhtkkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qwmA (A:)
    mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
    gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
    egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
    msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
    snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
    knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
    cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
    ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
    kalekhqkmm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qwmB (B:)
    mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
    gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
    egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
    msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
    snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
    knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
    cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
    ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
    kalekhqkmmkdmhgkdmhhtkkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qwmB (B:)
    mvnkdvkqttafgapvwddnnvitagprgpvllqstwfleklaafdreripervvhakgs
    gaygtftvtkditkytkakifskvgkktecffrfstvagergsadavrdprgfamkyyte
    egnwdlvgnntpvffirdaikfpdfihtqkrdpqtnlpnhdmvwdfwsnvpeslyqvtwv
    msdrgipksfrhmdgfgshtfslinakgerfwvkfhfhtmqgvkhltneeaaeirkhdpd
    snqrdlfdaiargdypkwklsiqvmpeedakkyrfhpfdvtkiwytqdyplmevgiveln
    knpenyfaeveqaaftpanvvpgigyspdrmlqgrlfsygdthryrlgvnypqipvnkpr
    cpfhsssrdgymqngyygslqnytpsslpgykedksardpkfnlahiekefevwnwdyra
    ddsdyytqpgdyyrslpadekerlhdtigeslahvthkeivdkqlehfkkadpkyaegvk
    kalekhqkmm