PDB entry 1qwk

View 1qwk on RCSB PDB site
Description: Structural genomics of Caenorhabditis Elegans: Hypothetical 35.2 kDa protein (aldose reductase family member)
Class: oxidoreductase
Keywords: Structural genomics; Caenorhabditis Elegans; aldo-keto reductase, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, OXIDOREDUCTASE
Deposited on 2003-09-02, released 2003-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo-keto reductase family 1 member C1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: C07D8.6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qwka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qwkA (A:)
    mssatasiklsngvempviglgtwqsspaevitavktavkagyrlidtasvyqneeaigt
    aikelleegvvkreelfittkawthelapgklegglreslkklqleyvdlylahmpaafn
    ddmsehiaspvedvwrqfdavykaglakavgvsnwnndqisralalgltpvhnsqvelhl
    yfpqhdhvdfckkhnisvtsyatlgspgrvnftlptgqkldwapapsdlqdqnvlalaek
    thktpaqvllryaldrgcailpksiqenrikenfevfdfslteediakleesknsqrlfl
    qdfmtghpedafaaerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qwkA (A:)
    tasiklsngvempviglgtwqsspaevitavktavkagyrlidtasvyqneeaigtaike
    lleegvvkreelfittkawthelapgklegglreslkklqleyvdlylahmpaafnddms
    ehiaspvedvwrqfdavykaglakavgvsnwnndqisralalgltpvhnsqvelhlyfpq
    hdhvdfckkhnisvtsyatlgspgrvnftlptgqkldwapapsdlqdqnvlalaekthkt
    paqvllryaldrgcailpksiqenrikenfevfdfslteediakleesknsqrlflqdfm
    tghpedafaaer