PDB entry 1qwf

View 1qwf on RCSB PDB site
Description: c-src sh3 domain complexed with ligand vsl12
Class: complex (signal transduction/peptide)
Keywords: src sh3 domain, class I ligand complex
Deposited on 1995-11-09, released 1996-03-08
The last revision prior to the SCOP 1.75 freeze date was dated 1996-03-08, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase transforming protein Src
    Species: Avian sarcoma virus
    Gene: CHICKEN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qwfa_
  • Chain 'B':
    Compound: val-ser-leu-ala-arg-arg-pro-leu-pro-pro-leu-pro

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qwfA (A:)
    gshmggvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsny
    vaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qwfA (A:)
    tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps
    

  • Chain 'B':
    No sequence available.