PDB entry 1qwf

View 1qwf on RCSB PDB site
Description: c-src sh3 domain complexed with ligand vsl12
Deposited on 1995-11-09, released 1996-03-08
The last revision prior to the SCOP 1.59 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1qwfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qwfA (A:)
    tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps