PDB entry 1qw2

View 1qw2 on RCSB PDB site
Description: Crystal Structure of a Protein of Unknown Function TA1206 from Thermoplasma acidophilum
Deposited on 2003-08-30, released 2004-03-09
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-09, with a file datestamp of 2004-03-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.203
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qw2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qw2A (A:)
    nyfqghmmqidsieiggkvyqffksdlgnapllfikgskgyamcgylnmetsnkvgdiav
    rvmgvktlddmlsakvveasqeaqkvginpgdvlrnvidklg