PDB entry 1qw1

View 1qw1 on RCSB PDB site
Description: Solution Structure of the C-Terminal Domain of DtxR residues 110-226
Class: gene regulation
Keywords: repressor, dtxr, c-terminal domain, prokaryotic sh3 domain, transcription regulation, peptide-binding, gene regulation
Deposited on 2003-08-29, released 2005-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: diphtheria toxin repressor
  Species: Corynebacterium diphtheriae [TaxId:1717]
  Gene: DTXR
  Database cross-references and differences (RAF-indexed):
  • Uniprot P33120 (4-120)
    • cloning artifact (0-3)
  Domains in SCOPe 2.08: d1qw1a1, d1qw1a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qw1A (A:)
  gshmdeverrlvkvlkdvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvri
  vqineifqvetdqftqlldadirvgseveivdrdghitlshngkdvellddlahtiriee
  l