PDB entry 1qvx

View 1qvx on RCSB PDB site
Description: solution structure of the fat domain of focal adhesion kinase
Class: transferase
Keywords: focal adhesion kinase, fak, focal adhension targeting domain, fat, nmr, helix bundle, transferase
Deposited on 2003-08-29, released 2004-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Focal adhesion kinase 1
  Species: Gallus gallus [TaxId:9031]
  Gene: FAK
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00944 (0-133)
  Domains in SCOPe 2.06: d1qvxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qvxA (A:)
  rsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdeslpvlpas
  threiemaqkllnsdlaelinkmklaqqyvmtslqqeykkqmltaahalavdaknlldvi
  dqarlkmisqsrph