PDB entry 1qvx

View 1qvx on RCSB PDB site
Description: solution structure of the fat domain of focal adhesion kinase
Class: transferase
Keywords: focal adhesion kinase, fak, focal adhension targeting domain, fat, nmr, helix bundle
Deposited on 2003-08-29, released 2004-03-02
The last revision prior to the SCOP 1.75 freeze date was dated 2004-03-02, with a file datestamp of 2007-06-28.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: GALLUS GALLUS
    Gene: FAK
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qvxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvxA (A:)
    rsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdeslpvlpas
    threiemaqkllnsdlaelinkmklaqqyvmtslqqeykkqmltaahalavdaknlldvi
    dqarlkmisqsrph