PDB entry 1qvr

View 1qvr on RCSB PDB site
Description: Crystal Structure Analysis of ClpB
Class: chaperone
Keywords: coiled coil, AAA ATPase, CHAPERONE
Deposited on 2003-08-28, released 2003-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.263
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clpb protein
    Species: Thermus thermophilus [TaxId:274]
    Gene: clpb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qvra1, d1qvra2, d1qvra3
  • Chain 'B':
    Compound: clpb protein
    Species: Thermus thermophilus [TaxId:274]
    Gene: clpb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qvrb1, d1qvrb2, d1qvrb3
  • Chain 'C':
    Compound: clpb protein
    Species: Thermus thermophilus [TaxId:274]
    Gene: clpb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qvrc1, d1qvrc2, d1qvrc3
  • Heterogens: PT, ANP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qvrA (A:)
    mnlerwtqaarealaqaqvlaqrmkhqaidlphlwavllkderslawrllekagadpkal
    kelqerelarlpkvegaevgqyltsrlsgalnraeglmeelkdryvavdtlvlalaeatp
    glpglealkgalkelrggrtvqtehaestynaleqygidltrlaaegkldpvigrdeeir
    rviqillrrtknnpvligepgvgktaiveglaqrivkgdvpeglkgkrivslqmgsllag
    akyrgefeerlkaviqevvqsqgevilfidelhtvvgagkaegavdagnmlkpalargel
    rligattldeyreiekdpalerrfqpvyvdeptveetisilrglkekyevhhgvrisdsa
    iiaaatlshryiterrlpdkaidlideaaarlrmalesapeeidalerkklqleiereal
    kkekdpdsqerlkaieaeiaklteeiaklraewerereilrklreaqhrldevrreiela
    erqydlnraaelrygelpkleaevealseklrgarfvrlevteediaeivsrwtgipvsk
    llegerekllrleeelhkrvvgqdeairavadairraraglkdpnrpigsflflgptgvg
    ktelaktlaatlfdteeamiridmteymekhavsrligappgyvgyeeggqlteavrrrp
    ysvilfdeiekahpdvfnillqilddgrltdshgrtvdfrntviiltsnlgsplileglq
    kgwpyerirdevfkvlqqhfrpeflnrldeivvfrpltkeqirqiveiqlsylrarlaek
    rislelteaakdflaergydpvfgarplrrviqreletplaqkilagevkegdrvqvdvg
    paglvfavparvea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvrA (A:)
    erwtqaarealaqaqvlaqrmkhqaidlphlwavllkderslawrllekagadpkalkel
    qerelarlpkvegaevgqyltsrlsgalnraeglmeelkdryvavdtlvlalaeatpglp
    glealkgalkelrggrtvqtehaestynaleqygidltrlaaegkldpvigrdeeirrvi
    qillrrtknnpvligepgvgktaiveglaqrivkgdvpeglkgkrivslqmefeerlkav
    iqevvqsqgevilfidelkpalargelrligattldeyreiekdpalerrfqpvyvdept
    veetisilrglkekyevhhgvrisdsaiiaaatlshryiterrlpdkaidlideaaarlr
    malesapeeidalerkklqleierealkkekdpdsqerlkaieaeiaklteeiaklraew
    erereilrklreaqhrldevrreielaerqydlnraaelrygelpkleaevealseklrg
    arfvrlevteediaeivsrwtgipvskllegerekllrleeelhkrvvgqdeairavada
    irraraglkdpnrpigsflflgptgvgktelaktlaatlfdteeamiridmteymekhav
    srlqlteavrrrpysvilfdeiekahpdvfnillqilddgrltdshgrtvdfrntviilt
    snlgsplileglqkgwpyerirdevfkvlqqhfrpeflnrldeivvfrpltkeqirqive
    iqlsylrarlaekrislelteaakdflaergydpvfgarplrrviqreletplaqkilag
    evkegdrvqvdvgpaglvfavpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qvrB (B:)
    mnlerwtqaarealaqaqvlaqrmkhqaidlphlwavllkderslawrllekagadpkal
    kelqerelarlpkvegaevgqyltsrlsgalnraeglmeelkdryvavdtlvlalaeatp
    glpglealkgalkelrggrtvqtehaestynaleqygidltrlaaegkldpvigrdeeir
    rviqillrrtknnpvligepgvgktaiveglaqrivkgdvpeglkgkrivslqmgsllag
    akyrgefeerlkaviqevvqsqgevilfidelhtvvgagkaegavdagnmlkpalargel
    rligattldeyreiekdpalerrfqpvyvdeptveetisilrglkekyevhhgvrisdsa
    iiaaatlshryiterrlpdkaidlideaaarlrmalesapeeidalerkklqleiereal
    kkekdpdsqerlkaieaeiaklteeiaklraewerereilrklreaqhrldevrreiela
    erqydlnraaelrygelpkleaevealseklrgarfvrlevteediaeivsrwtgipvsk
    llegerekllrleeelhkrvvgqdeairavadairraraglkdpnrpigsflflgptgvg
    ktelaktlaatlfdteeamiridmteymekhavsrligappgyvgyeeggqlteavrrrp
    ysvilfdeiekahpdvfnillqilddgrltdshgrtvdfrntviiltsnlgsplileglq
    kgwpyerirdevfkvlqqhfrpeflnrldeivvfrpltkeqirqiveiqlsylrarlaek
    rislelteaakdflaergydpvfgarplrrviqreletplaqkilagevkegdrvqvdvg
    paglvfavparvea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvrB (B:)
    erwtqaarealaqaqvlaqrmkhqaidlphlwavllkderslawrllekagadpkalkel
    qerelarlpkvegaevgqyltsrlsgalnraeglmeelkdryvavdtlvlalaeatpglp
    glealkgalkelrggrtvqtehaestynaleqygidltrlaaegkldpvigrdeeirrvi
    qillrrtknnpvligepgvgktaiveglaqrivkgdvpeglkgkrivslqmefeerlkav
    iqevvqsqgevilfidelkpalargelrligattldeyreiekdpalerrfqpvyvdept
    veetisilrglkekyevhhgvrisdsaiiaaatlshryiterrlpdkaidlideaaarlr
    malesapeeidalerkklqleierealkkekdpdsqerlkaieaeiaklteeiaklraew
    erereilrklreaqhrldevrreielaerqydlnraaelrygelpkleaevealseklrg
    arfvrlevteediaeivsrwtgipvskllegerekllrleeelhkrvvgqdeairavada
    irraraglkdpnrpigsflflgptgvgktelaktlaatlfdteeamiridmteymekhav
    srlqlteavrrrpysvilfdeiekahpdvfnillqilddgrltdshgrtvdfrntviilt
    snlgsplileglqkgwpyerirdevfkvlqqhfrpeflnrldeivvfrpltkeqirqive
    iqlsylrarlaekrislelteaakdflaergydpvfgarplrrviqreletplaqkilag
    evkegdrvqvdvgpaglvfavpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qvrC (C:)
    mnlerwtqaarealaqaqvlaqrmkhqaidlphlwavllkderslawrllekagadpkal
    kelqerelarlpkvegaevgqyltsrlsgalnraeglmeelkdryvavdtlvlalaeatp
    glpglealkgalkelrggrtvqtehaestynaleqygidltrlaaegkldpvigrdeeir
    rviqillrrtknnpvligepgvgktaiveglaqrivkgdvpeglkgkrivslqmgsllag
    akyrgefeerlkaviqevvqsqgevilfidelhtvvgagkaegavdagnmlkpalargel
    rligattldeyreiekdpalerrfqpvyvdeptveetisilrglkekyevhhgvrisdsa
    iiaaatlshryiterrlpdkaidlideaaarlrmalesapeeidalerkklqleiereal
    kkekdpdsqerlkaieaeiaklteeiaklraewerereilrklreaqhrldevrreiela
    erqydlnraaelrygelpkleaevealseklrgarfvrlevteediaeivsrwtgipvsk
    llegerekllrleeelhkrvvgqdeairavadairraraglkdpnrpigsflflgptgvg
    ktelaktlaatlfdteeamiridmteymekhavsrligappgyvgyeeggqlteavrrrp
    ysvilfdeiekahpdvfnillqilddgrltdshgrtvdfrntviiltsnlgsplileglq
    kgwpyerirdevfkvlqqhfrpeflnrldeivvfrpltkeqirqiveiqlsylrarlaek
    rislelteaakdflaergydpvfgarplrrviqreletplaqkilagevkegdrvqvdvg
    paglvfavparvea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvrC (C:)
    erwtqaarealaqaqvlaqrmkhqaidlphlwavllkderslawrllekagadpkalkel
    qerelarlpkvegaevgqyltsrlsgalnraeglmeelkdryvavdtlvlalaeatpglp
    glealkgalkelrggrtvqtehaestynaleqygidltrlaaegkldpvigrdeeirrvi
    qillrrtknnpvligepgvgktaiveglaqrivkgdvpeglkgkrivslqmefeerlkav
    iqevvqsqgevilfidelkpalargelrligattldeyreiekdpalerrfqpvyvdept
    veetisilrglkekyevhhgvrisdsaiiaaatlshryiterrlpdkaidlideaaarlr
    malesapeeidalerkklqleierealkkekdpdsqerlkaieaeiaklteeiaklraew
    erereilrklreaqhrldevrreielaerqydlnraaelrygelpkleaevealseklrg
    arfvrlevteediaeivsrwtgipvskllegerekllrleeelhkrvvgqdeairavada
    irraraglkdpnrpigsflflgptgvgktelaktlaatlfdteeamiridmteymekhav
    srlqlteavrrrpysvilfdeiekahpdvfnillqilddgrltdshgrtvdfrntviilt
    snlgsplileglqkgwpyerirdevfkvlqqhfrpeflnrldeivvfrpltkeqirqive
    iqlsylrarlaekrislelteaakdflaergydpvfgarplrrviqreletplaqkilag
    evkegdrvqvdvgpaglvfavpa