PDB entry 1qvp

View 1qvp on RCSB PDB site
Description: C terminal SH3-like domain from Diphtheria toxin Repressor residues 144-226.
Class: DNA binding protein
Keywords: repressor, dtxr, c-terminal domain, prokaryotic sh3 domain, transcription regulation, peptide-binding, gene regulation, DNA binding protein
Deposited on 2003-08-28, released 2004-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DTXR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120 (4-86)
      • cloning artifact (0-3)
    Domains in SCOPe 2.08: d1qvpa1, d1qvpa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvpA (A:)
    gshmdaaapgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrd
    ghitlshngkdvellddlahtirieel