PDB entry 1qvi

View 1qvi on RCSB PDB site
Description: Crystal structure of scallop myosin S1 in the pre-power stroke state to 2.6 Angstrom resolution: flexibility and function in the head
Class: contractile protein
Keywords: scallop myosin subfragment-1 (S1), pre-power stroke state, pliant region, internally-uncoupled state, SH1 helix
Deposited on 2003-08-27, released 2003-12-16
The last revision prior to the SCOP 1.75 freeze date was dated 2003-12-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.212
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin heavy chain, striated muscle
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qvia1, d1qvia2
  • Chain 'Y':
    Compound: myosin regulatory light chain, striated adductor muscle
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qviy_
  • Chain 'Z':
    Compound: myosin essential light chain, striated adductor muscle
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qviz_
  • Heterogens: MG, VO4, CA, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qviA (A:)
    mnidfsdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvki
    vadsstrtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfc
    iavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesga
    gktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnns
    srfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvm
    lvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmge
    mkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvv
    nsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinyt
    nerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfp
    kaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkd
    pinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknl
    ysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqry
    silapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlsk
    iismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkpllsia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qviA (A:)
    sdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvkivadss
    trtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavnp
    yrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagkten
    tkkvimylakvacavkegsledqiiqanpvleaygnakttrnnnssrfgkfirihfgptg
    kiagadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtpdsglysfinqg
    cltvdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfkqrpreeqaesd
    gtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvvnsvgalakslydrmf
    nwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinytnerlqqffnhhmfil
    eqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfpkaddksfqdklyqnh
    mgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkdpinenvvallgaske
    plvaelfkapeefqtisavhreslnklmknlysthphfvrciipnelkqpglvdaelvlh
    qlqcngvlegiricrkgfpsrliysefkqrysilapnaipfvdgktvsekilaglqmdpa
    eyrlgttkvffkagvlgnleemrderlskiismfqahirgylirkaykklqdqriglsvi
    qrnirkwlvlrnwqwwklyskvkpll
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1qviY (Y:)
    adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml
    keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf
    nkdemrmtfkeapveggkfdyvkftamikgsgeeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qviY (Y:)
    lpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftm
    flsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfke
    apveggkfdyvkftamikgsg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1qviZ (Z:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qviZ (Z:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpypd