PDB entry 1qvg

View 1qvg on RCSB PDB site
Description: Structure of CCA oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of Haloarcula marismortui
Class: ribosome
Keywords: ribosome 50S, PROTEIN-PROTEIN COMPLEX, RNA-RNA COMPLEX, PROTEIN-RNA COMPLEX
Deposited on 2003-08-27, released 2003-11-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.201
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 23S ribosomal RNA
    Species: Haloarcula marismortui [TaxId:2238]
  • Chain '1':
    Compound: 50S ribosomal protein L39e
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvg1_
  • Chain '2':
    Compound: 50S ribosomal protein L44E
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvg2_
  • Chain '3':
    Compound: Oligonucleotide CCA
  • Chain '4':
    Compound: Oligonucleotide CCA
  • Chain '5':
    Compound: Oligonucleotide CCA
  • Chain '9':
    Compound: 5S ribosomal RNA
    Species: Haloarcula marismortui [TaxId:2238]
  • Chain 'A':
    Compound: 50S ribosomal protein L2P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvga1, d1qvga2
  • Chain 'B':
    Compound: 50S ribosomal protein L3P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20279 (0-336)
      • conflict (309)
    Domains in SCOPe 2.04: d1qvgb_
  • Chain 'C':
    Compound: 50S ribosomal protein L4E
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgc_
  • Chain 'D':
    Compound: 50S ribosomal protein L5P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgd_
  • Chain 'E':
    Compound: 50S ribosomal protein L6P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvge1, d1qvge2
  • Chain 'F':
    Compound: 50S ribosomal protein L7Ae
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgf_
  • Chain 'G':
    Compound: 50S ribosomal protein L10e
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgg_
  • Chain 'H':
    Compound: L10 Ribosomal Protein
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QVG (0-166)
    Domains in SCOPe 2.04: d1qvgh_
  • Chain 'I':
    Compound: 50S ribosomal protein L13P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgi_
  • Chain 'J':
    Compound: 50S ribosomal protein L14P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgj_
  • Chain 'K':
    Compound: 50S ribosomal protein L15P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgk_
  • Chain 'L':
    Compound: L15 Ribosomal Protein
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QVG (0-193)
    Domains in SCOPe 2.04: d1qvgl_
  • Chain 'M':
    Compound: 50S ribosomal protein L18P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgm_
  • Chain 'N':
    Compound: 50S ribosomal protein L18e
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgn_
  • Chain 'O':
    Compound: 50S ribosomal protein L19e
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14119 (0-End)
      • conflict (70)
    Domains in SCOPe 2.04: d1qvgo_
  • Chain 'P':
    Compound: 50S ribosomal protein L21e
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgp_
  • Chain 'Q':
    Compound: 50S ribosomal protein L22P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgq_
  • Chain 'R':
    Compound: 50S ribosomal protein L23P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgr_
  • Chain 'S':
    Compound: 50S ribosomal protein L24P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgs_
  • Chain 'T':
    Compound: 50S ribosomal protein L24e
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgt_
  • Chain 'U':
    Compound: 50S ribosomal protein L29P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgu_
  • Chain 'V':
    Compound: 50S ribosomal protein L30P
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgv_
  • Chain 'W':
    Compound: 50S ribosomal protein L31e
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgw_
  • Chain 'X':
    Compound: 50S ribosomal protein L32e
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgx_
  • Chain 'Y':
    Compound: L37Ae 50S ribosomal protein
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QVG (0-72)
    Domains in SCOPe 2.04: d1qvgy_
  • Chain 'Z':
    Compound: 50S ribosomal protein L37e
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qvgz_
  • Heterogens: MG, K, NA, CL, CD, HOH

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1qvg1 (1:)
    gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvg1 (1:)
    gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvg2 (2:)
    mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
    ptkktdlkyrcgecgkahlregwragrlefqe
    

  • Chain '3':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain '9':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qvgA (A:)
    grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
    edgdrrlilapegvgvgdelqvgvdaeiapgntlplaeipegvpvcnvesspgdggkfar
    asgvnaqllthdrnvavvklpsgemkrldpqcratigvvggggrtdkpfvkagnkhhkmk
    argtkwpnvrgvamnavdhpfggggrqhpgkpksisrnappgrkvgdiaskrtgrggne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgA (A:)
    grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
    edgdrrlilapegvgvgdelqvgvdaeiapgntlplaeipegvpvcnvesspgdggkfar
    asgvnaqllthdrnvavvklpsgemkrldpqcratigvvggggrtdkpfvkagnkhhkmk
    argtkwpnvrgvamnavdhpfggggrqhpgkpksisrnappgrkvgdiaskrtgrgg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvgB (B:)
    pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
    pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
    pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
    ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
    pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
    vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvgC (C:)
    mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
    fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
    adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
    argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
    aevaer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qvgD (D:)
    ssesesggdfhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvge
    fdiregdpigakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeyd
    psigiygldvtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvevse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgD (D:)
    fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
    lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
    hrlnpadavafiestydvev
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qvgE (E:)
    prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
    tigtfqshienmfhgvtegweygmevfyshfpmqvnvegdevvienflgekaprrttihg
    dtdveidgeeltvsgpdieavgqtaadieqltrindkdvrvfqdgvyitrkpnrgda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgE (E:)
    prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
    tigtfqshienmfhgvtegweygmevfyshfpmqvnvegdevvienflgekaprrttihg
    dtdveidgeeltvsgpdieavgqtaadieqltrindkdvrvfqdgvyitrkp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvgF (F:)
    pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
    mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1qvgG (G:)
    msaeserktetipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelr
    vsrntlleralddvddgledlngyitgqvgligtddnpfslfqeleasktpapigageva
    pndivipegdtgvdpgpfvgelqsvgadariqegsiqvlsdstvldtgeevsqelsnvln
    elgiepkevgldlravfadgvlfepeeleldideyrsdiqaaagrafnlsvnadyptatt
    aptmlqsdrgnakslalqaaiedpevvpdlvskadaqvralasqiddeealpeelqgvea
    dvateeptddqdddtaseddadaddaaeeadddddddedagdalgamf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgG (G:)
    ipewkqeevdaivemiesrntlleraldd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1qvgH (H:)
    kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
    leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
    taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgH (H:)
    kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
    leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
    fiawvnpdpnveeawrrakmkvtptinidsspagna
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1qvgI (I:)
    msvaefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekr
    vdigndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgts
    ldrlsnikfvtlgeisetlganktw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgI (I:)
    aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
    gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
    lsnikfvtlgeisetlganktw
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvgJ (J:)
    mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
    tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
    fgsvasaatmiv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1qvgK (K:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
    iaddfsegarekvegaggsveltdlgeerqaeaeetedadadee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgK (K:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
    segarekvegaggsveltdlgeerq
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvgL (L:)
    arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
    ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
    gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
    ekvrpslrvngaka
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvgM (M:)
    atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
    ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
    gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
    dgdiel
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvgN (N:)
    sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
    pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1qvgO (O:)
    tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
    rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
    dlydkagggefdsvadleryidanhgda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgO (O:)
    tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
    rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
    dlydkagggefdsvadleryida
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvgP (P:)
    pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
    gtvegkqgdaykvdivdggkektiivtaahlrrqe
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1qvgQ (Q:)
    gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
    qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
    eqqgrkpramgrasawnspqvdvelileepeved
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgQ (Q:)
    gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
    qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
    eqqgrkpramgrasawnspqvdvelileep
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1qvgR (R:)
    swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
    ekkavvrlsedddaqevasrigvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgR (R:)
    swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
    ekkavvrlsedddaqevasri
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvgS (S:)
    skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
    evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1qvgT (T:)
    prtrecdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtargeag
    eaedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgT (T:)
    recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1qvgU (U:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegdlqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgU (U:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegd
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvgV (V:)
    mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
    tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
    prgghdgvkhpvkeggqlgkhdtegiddlleamr
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1qvgW (W:)
    sasdfeervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawa
    rgrantpskirvraarfeeegeaiveaetae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgW (W:)
    ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
    pskirvraarfeeegeaiveae
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1qvgX (X:)
    adneedveaeeeyteltdisgvgpskaeslreagfesvedvrgadqsaladvsgignala
    arikadvggleveseteaeveeeggeeapdedvetelqargltektpdlsdedarlltqr
    hrvgkpqfnrqdhhkkkrvstswrkprgqlskqrrgikgkgdtveagfrsptavrgkhps
    gfeevrvhnvddlegvdgdteavriaskvgarkrerieeeaedagirvlnptyvevevse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvgX (X:)
    telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
    rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
    erieeeaedagirvlnptyvev
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvgY (Y:)
    rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
    qpetvagkavmka
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvgZ (Z:)
    tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage