PDB entry 1qve

View 1qve on RCSB PDB site
Description: Crystal structure of the truncated K122-4 pilin from Pseudomonas aeruginosa
Deposited on 2003-08-27, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.141
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1qvea_
  • Chain 'B':
    Domains in SCOP 1.69: d1qveb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qveA (A:)
    isefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakvttg
    gtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpktcqt
    attttp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qveB (B:)
    isefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakvttg
    gtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpktcqt
    attttp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qveB (B:)
    isefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakvttg
    gtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpktcqt
    atttt