PDB entry 1qvc

View 1qvc on RCSB PDB site
Description: crystal structure analysis of single stranded DNA binding protein (ssb) from e.coli
Class: DNA binding protein
Keywords: beta-barrel, single stranded DNA binding protein
Deposited on 1999-07-07, released 2000-06-05
The last revision prior to the SCOP 1.75 freeze date was dated 2000-06-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.247
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single stranded DNA binding protein monomer
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qvca_
  • Chain 'B':
    Compound: single stranded DNA binding protein monomer
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qvcb_
  • Chain 'C':
    Compound: single stranded DNA binding protein monomer
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qvcc_
  • Chain 'D':
    Compound: single stranded DNA binding protein monomer
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qvcd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvcA (A:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqqpqggn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qvcB (B:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqqpqggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvcB (B:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqqpqgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qvcC (C:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqqpqggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvcC (C:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqqpqgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qvcD (D:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqqpqggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvcD (D:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqq