PDB entry 1qvc

View 1qvc on RCSB PDB site
Description: crystal structure analysis of single stranded dna binding protein (ssb) from e.coli
Deposited on 1999-07-07, released 2000-06-05
The last revision prior to the SCOP 1.67 freeze date was dated 2000-06-05, with a file datestamp of 2000-06-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.247
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qvca_
  • Chain 'B':
    Domains in SCOP 1.67: d1qvcb_
  • Chain 'C':
    Domains in SCOP 1.67: d1qvcc_
  • Chain 'D':
    Domains in SCOP 1.67: d1qvcd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvcA (A:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqqpqggn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qvcB (B:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqqpqggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvcB (B:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqqpqgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qvcC (C:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqqpqggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvcC (C:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqqpqgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qvcD (D:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqqpqggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvcD (D:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggwgqpqq