PDB entry 1qvb

View 1qvb on RCSB PDB site
Description: crystal structure of the beta-glycosidase from the hyperthermophile thermosphaera aggregans
Deposited on 1999-07-07, released 1999-07-13
The last revision prior to the SCOP 1.63 freeze date was dated 2000-06-23, with a file datestamp of 2000-06-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1qvba_
  • Chain 'B':
    Domains in SCOP 1.63: d1qvbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvbA (A:)
    mkfpkdfmigyssspfqfeagipgsedpnsdwwvwvhdpentaaglvsgdfpengpgywn
    lnqndhdlaeklgvntirvgvewsrifpkptfnvkvpverdengsivhvdvddkaverld
    elankeavnhyvemykdwvergrklilnlyhwplplwlhnpimvrrmgpdrapsgwlnee
    svvefakyaayiawkmgelpvmwstmnepnvvyeqgymfvkggfppgylsleaadkarrn
    miqaharaydnikrfskkpvgliyafqwfellegpaevfdkfkssklyyftdivskgssi
    inveyrrdlanrldwlgvnyysrlvykivddkpiilhgygflctpggispaenpcsdfgw
    evypeglylllkelynrygvdlivtengvsdsrdalrpaylvshvysvwkaanegipvkg
    ylhwsltdnyewaqgfrqkfglvmvdfktkkrylrpsalvfreiathngipdelqhltli
    q
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvbB (B:)
    mkfpkdfmigyssspfqfeagipgsedpnsdwwvwvhdpentaaglvsgdfpengpgywn
    lnqndhdlaeklgvntirvgvewsrifpkptfnvkvpverdengsivhvdvddkaverld
    elankeavnhyvemykdwvergrklilnlyhwplplwlhnpimvrrmgpdrapsgwlnee
    svvefakyaayiawkmgelpvmwstmnepnvvyeqgymfvkggfppgylsleaadkarrn
    miqaharaydnikrfskkpvgliyafqwfellegpaevfdkfkssklyyftdivskgssi
    inveyrrdlanrldwlgvnyysrlvykivddkpiilhgygflctpggispaenpcsdfgw
    evypeglylllkelynrygvdlivtengvsdsrdalrpaylvshvysvwkaanegipvkg
    ylhwsltdnyewaqgfrqkfglvmvdfktkkrylrpsalvfreiathngipdelqhltli
    q