PDB entry 1qv7

View 1qv7 on RCSB PDB site
Description: horse liver alcohol dehydrogenase his51gln/lys228arg mutant complexed with nad+ and 2,3-difluorobenzyl alcohol
Class: oxidoreductase
Keywords: dehydrogenase, alcohol, nicotinamide coenzyme, 2,3-difluorobenzyl alcohol, his51gln/lys228arg mutant, horse liver, oxidoreductase
Deposited on 2003-08-27, released 2004-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase e chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (50)
      • engineered (227)
    Domains in SCOPe 2.06: d1qv7a1, d1qv7a2
  • Chain 'B':
    Compound: alcohol dehydrogenase e chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (50)
      • engineered (227)
    Domains in SCOPe 2.06: d1qv7b1, d1qv7b2
  • Heterogens: ZN, NAD, DFB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qv7A (A:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddqvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdrfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qv7B (B:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddqvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdrfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf