PDB entry 1qv6

View 1qv6 on RCSB PDB site
Description: horse liver alcohol dehydrogenase his51gln/lys228arg mutant complexed with nad+ and 2,4-difluorobenzyl alcohol
Class: oxidoreductase
Keywords: dehydrogenase, alcohol, nicotinamide coenzyme, 2,4-difluorobenzyl alcohol, his51gln/lys228arg mutant, horse liver, oxidoreductase
Deposited on 2003-08-26, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.158
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase e chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (50)
      • engineered (227)
    Domains in SCOPe 2.07: d1qv6a1, d1qv6a2
  • Chain 'B':
    Compound: alcohol dehydrogenase e chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00327 (0-373)
      • engineered (50)
      • engineered (227)
    Domains in SCOPe 2.07: d1qv6b1, d1qv6b2
  • Heterogens: ZN, NAD, 24B, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qv6A (A:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddqvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdrfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qv6B (B:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddqvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdrfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf