PDB entry 1qv1

View 1qv1 on RCSB PDB site
Description: atomic resolution structure of obelin from obelia longissima
Deposited on 2003-08-26, released 2003-11-11
The last revision prior to the SCOP 1.71 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.133
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1qv1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qv1A (A:)
    msskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeq
    tkrhqvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfd
    ifdkdgsgtitldewkaygkisgispsqedceatfrhcdldnagdldvdemtrqhlgfwy
    tldpeadglygngvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qv1A (A:)
    yavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrh
    qvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdifdg
    titldewkaygkisgispsqedceatfrhcdldnagdldvdemtrqhlgfwytldpeadg
    lygngvp