PDB entry 1quw

View 1quw on RCSB PDB site
Description: solution structure of the thioredoxin from bacillus acidocaldarius
Class: electron transport
Keywords: alpha/beta open-twisted protein, thiol-disulfide, electron transport
Deposited on 1999-07-02, released 2000-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1quwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1quwA (A:)
    atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq