PDB entry 1qut

View 1qut on RCSB PDB site
Description: the soluble lytic transglycosylase slt35 from escherichia coli in complex with n-acetylglucosamine
Class: hydrolase
Keywords: alpha-helical protein with a five-stranded antiparallel beta-strand, hydrolase
Deposited on 1999-07-03, released 1999-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.191
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lytic murein transglycosylase b
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41052 (0-321)
      • engineered (0-1)
    Domains in SCOPe 2.06: d1quta_
  • Heterogens: NAG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qutA (A:)
    mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqa
    pttsvkppsgpngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgii
    gvetrwgrvmgktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfag
    amgygqfmpssykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqa
    pglpngfktkysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitryn
    hsthyamavwqlgqavalarvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qutA (A:)
    mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqg
    pngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgiigvetrwgrvm
    gktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfagamgygqfmps
    sykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqapglpngfktk
    ysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitrynhsthyamavw
    qlgqavalarvq