PDB entry 1qup

View 1qup on RCSB PDB site
Description: crystal structure of the copper chaperone for superoxide dismutase
Class: chaperone
Keywords: two domains, beta-alpha-beta-beta-alpha-beta and beta barrel, chaperone
Deposited on 1999-07-01, released 1999-12-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase 1 copper chaperone
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40202 (0-End)
      • modified residue (13)
      • modified residue (44)
    Domains in SCOPe 2.08: d1qupa1, d1qupa2
  • Chain 'B':
    Compound: superoxide dismutase 1 copper chaperone
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40202 (Start-221)
      • modified residue (13)
      • modified residue (44)
    Domains in SCOPe 2.08: d1qupb1, d1qupb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qupA (A:)
    ttndtyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintl
    rncgkdaiirgagkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvn
    gvpeagnyhasihekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplp
    twqligrsfviskslnhpenepssvkdysflgviarsagvwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qupA (A:)
    ttndtyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintl
    rncgkdaiirgagkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvn
    gvpeagnyhasihekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplp
    twqligrsfviskslnhpenepssvkdysflgviarsagvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qupB (B:)
    ttndtyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintl
    rncgkdaiirgagkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvn
    gvpeagnyhasihekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplp
    twqligrsfviskslnhpenepssvkdysflgviarsagvwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qupB (B:)
    dtyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintlrnc
    gkdaiirgagkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvp
    eagnyhasihekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwq
    ligrsfviskslnhpenepssvkdysflgviarsagvwe