PDB entry 1qun

View 1qun on RCSB PDB site
Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli
Deposited on 1999-07-01, released 1999-08-31
The last revision prior to the SCOP 1.61 freeze date was dated 1999-08-31, with a file datestamp of 1999-08-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qunA (A:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qunA (A:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklsni
    tyrtindygaltpkmtgvme
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qunB (B:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qunC (C:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qunC (C:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklsni
    tyrtindygaltpkmtgvme
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qunD (D:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qunE (E:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qunE (E:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklsni
    tyrtindygaltpkmtgvme
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qunF (F:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1qunG (G:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qunG (G:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklsni
    tyrtindygaltpkmtgvme
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qunH (H:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1qunI (I:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qunI (I:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskentlqlaiisriklyyrpaklal
    ppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklsnity
    rtindygaltpkmtgvme
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qunJ (J:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1qunK (K:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qunK (K:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskentlqlaiisriklyyrpaklal
    ppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklsnity
    rtindygaltpkmtgvme
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qunL (L:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1qunM (M:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qunM (M:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskentlqlaiisriklyyrpaklal
    ppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklsnity
    rtindygaltpkmtgvme
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qunN (N:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1qunO (O:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qunO (O:)
    gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskentlqlaiisriklyyrpaklal
    ppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklsnity
    rtindygaltpkmtgvme
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qunP (P:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq