SCOPe 2.08: Structural Classification of Proteins

PDB entry 1qub

View 1qub on RCSB PDB site
Description: crystal structure of the glycosylated five-domain human beta2-glycoprotein I purified from blood plasma
Class: membrane adhesion
Keywords: short consensus repeat, sushi, complement control protein, n-glycosylation, multi-domain, membrane adhesion
Deposited on 1999-07-01, released 1999-10-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: PROTEIN (human beta2-Glycoprotein I)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P02749 (0-318)
Domains in SCOPe 2.08: d1quba1, d1quba2, d1quba3, d1quba4, d1quba5
Heterogens: NAG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)

>1qubA (A:)
grtcpkpddlpfstvvplktfyepgeeitysckpgyvsrggmrkficpltglwpintlkc
tprvcpfagilengavryttfeypntisfscntgfylngadsakcteegkwspelpvcap
iicpppsiptfatlrvykpsagnnslyrdtavfeclpqhamfgndtitctthgnwtklpe
crevkcpfpsrpdngfvnypakptlyykdkatfgchdgysldgpeeiectklgnwsamps
ckasckvpvkkatvvyqgervkiqekfkngmlhgdkvsffcknkekkcsytedaqcidgt
ievpkcfkehtdasdvkpc