PDB entry 1qua

View 1qua on RCSB PDB site
Description: crystal structure of acutolysin-c, a hemorrhagic toxin from the snake venom of agkistrodon acutus, at 2.2 a resolution
Class: toxin
Keywords: metalloprotease, hemorrhagic toxin, snake venom proteinase, crystal structure, agkistrodon acutus
Deposited on 1999-06-30, released 2000-07-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.176
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: acutolysin-c
  Species: Deinagkistrodon acutus [TaxId:36307]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9W7S2 (8-178)
  Domains in SCOPe 2.05: d1quaa_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1quaA (A:)
  papqtsielflivdhsmyakynsnsskitttlkarvnimnaiysslnlvitlsgiemwsa
  adlitvqsssrntlklfaswretdllkrtsndnaqlltatnfngntvglaylktmcnsky
  svgliqdhsaipllmavtmahelghnlgmnhdgagcscatcimapvlssgpaksfsdcsk
  hdyqsfltihkpqclln