PDB entry 1qua

View 1qua on RCSB PDB site
Description: crystal structure of acutolysin-c, a hemorrhagic toxin from the snake venom of agkistrodon acutus, at 2.2 a resolution
Deposited on 1999-06-30, released 2000-07-05
The last revision prior to the SCOP 1.71 freeze date was dated 2000-07-05, with a file datestamp of 2000-07-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.176
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1quaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1quaA (A:)
    papqtsielflivdhsmyakynsnsskitttlkarvnimnaiysslnlvitlsgiemwsa
    adlitvqsssrntlklfaswretdllkrtsndnaqlltatnfngntvglaylktmcnsky
    svgliqdhsaipllmavtmahelghnlgmnhdgagcscatcimapvlssgpaksfsdcsk
    hdyqsfltihkpqclln