PDB entry 1qu6

View 1qu6 on RCSB PDB site
Description: structure of the double-stranded RNA-binding domain of the protein kinase pkr reveals the molecular basis of its dsRNA-mediated activation
Class: transferase
Keywords: dsRNA-binding domain, nmr, pkr, solution structure, protein kinase, transferase
Deposited on 1999-07-08, released 1999-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase pkr
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qu6a1, d1qu6a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qu6A (A:)
    gshmemagdlsagffmeelntyrqkqgvvlkyqelpnsgpphdrrftfqviidgrefpeg
    egrskkeaknaaaklaveilnkekkavspllltttnsseglsmgnyiglinriaqkkrlt
    vnyeqcasgvhgpegfhykckmgqkeysigtgstkqeakqlaaklaylqilseetgsgc