PDB entry 1qu6

View 1qu6 on RCSB PDB site
Description: structure of the double-stranded rna-binding domain of the protein kinase pkr reveals the molecular basis of its dsrna-mediated activation
Deposited on 1999-07-08, released 1999-12-23
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-23, with a file datestamp of 1999-12-22.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qu6A (A:)
    gshmemagdlsagffmeelntyrqkqgvvlkyqelpnsgpphdrrftfqviidgrefpeg
    egrskkeaknaaaklaveilnkekkavspllltttnsseglsmgnyiglinriaqkkrlt
    vnyeqcasgvhgpegfhykckmgqkeysigtgstkqeakqlaaklaylqilseetgsgc