PDB entry 1qu4

View 1qu4 on RCSB PDB site
Description: crystal structure of trypanosoma brucei ornithine decarboxylase
Deposited on 1999-07-06, released 1999-11-17
The last revision prior to the SCOP 1.67 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.245
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qu4A (A:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakkvtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu4A (A:)
    degdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnte
    iqrvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlr
    istlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmg
    telgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvas
    aftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssv
    wgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qu4B (B:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakkvtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu4B (B:)
    degdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnte
    iqrvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlr
    istlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmg
    telgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvas
    aftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssv
    wgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qu4C (C:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakkvtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu4C (C:)
    degdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnte
    iqrvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlr
    istlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmg
    telgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvas
    aftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssv
    wgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qu4D (D:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakkvtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu4D (D:)
    degdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnte
    iqrvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlr
    istlsvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmg
    telgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvas
    aftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssv
    wgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsg