PDB entry 1qu3

View 1qu3 on RCSB PDB site
Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin
Deposited on 1999-07-06, released 1999-08-31
The last revision prior to the SCOP 1.59 freeze date was dated 2001-01-17, with a file datestamp of 2001-01-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.234
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qu3A (A:)
    dyektllmpktdfpmrgglpnkepqiqekwdaedqyhkaleknkgnetfilhdgppyang
    nlhmghalnkilkdfivryktmqgfyapyvpgwdthglpieqaltkkgvdrkkmstaefr
    ekckefaleqielqkkdfrrlgvrgdfndpyitlkpeyeaaqirifgemadkgliykgkk
    pvywspssesslaeaeieyhdkrsasiyvafnvkddkgvvdadakfiiwtttpwtipsnv
    aitvhpelkygqynvngekyiiaealsdavaealdwdkasiklekeytgkelewvvaqhp
    fldreslvingdhvttdagtgcvhtapghgeddyivgqqyelpvispiddkgvfteeggq
    fegmfydkankavtdlltekgallkldfithsyphdwrtkkpvifratpqwfasiskvrq
    dildaientnfkvnwgktriynmvrdrgewvisrqrvwgvplpvfyaengeiimtketvn
    hvadlfaehgsniwfereakdllpegfthpgspngtftketdimdvwfdsgsshrgvlet
    rpelsfpadmylegsdqyrgwfnssittsvatrgvspykfllshgfvmdgegkkmskslg
    nvivpdqvvkqkgadiarlwvsstdyladvrisdeilkqtsddyrkirntlrfmlgnind
    fnpdtdsipesellevdryllnrlreftastinnyenfdylniyqevqnfinvelsnfyl
    dygkdilyieqrdshirrsmqtvlyqilvdmtkllapilvhtaeevwshtphvkeesvhl
    admpkvvevdqalldkwrtfmnlrddvnraletarnekvigksleakvtiasndkfnase
    fltsfdalhqlfivsqvkvvdklddqatayehgdivieha