PDB entry 1qu2

View 1qu2 on RCSB PDB site
Description: insights into editing from an ile-tRNA synthetase structure with tRNA(ile) and mupirocin
Class: ligase/RNA
Keywords: protein-RNA complex, metal ions, editing tRNA synthetase, double-sieve, ligase/RNA complex
Deposited on 1999-07-06, released 1999-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.239
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isoleucyl-tRNA synthetase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41972 (0-916)
      • conflict (3-4)
      • conflict (294)
      • conflict (339)
      • conflict (643)
    Domains in SCOPe 2.06: d1qu2a1, d1qu2a2, d1qu2a3
  • Chain 'T':
    Compound: isoleucyl-tRNA
    Species: Staphylococcus aureus [TaxId:1280]
  • Heterogens: K, ZN, MG, MRC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qu2A (A:)
    mdyektllmpktdfpmrgglpnkepqiqekwdaedqyhkaleknkgnetfilhdgppyan
    gnlhmghalnkilkdfivryktmqgfyapyvpgwdthglpieqaltkkgvdrkkmstaef
    rekckefaleqielqkkdfrrlgvrgdfndpyitlkpeyeaaqirifgemadkgliykgk
    kpvywspssesslaeaeieyhdkrsasiyvafnvkddkgvvdadakfiiwtttpwtipsn
    vaitvhpelkygqynvngekyiiaealsdavaealdwdkasiklekeytgkelewvvaqh
    pfldreslvingdhvttdagtgcvhtapghgeddyivgqqyelpvispiddkgvfteegg
    qfegmfydkankavtdlltekgallkldfithsyphdwrtkkpvifratpqwfasiskvr
    qdildaientnfkvnwgktriynmvrdrgewvisrqrvwgvplpvfyaengeiimtketv
    nhvadlfaehgsniwfereakdllpegfthpgspngtftketdimdvwfdsgsshrgvle
    trpelsfpadmylegsdqyrgwfnssittsvatrgvspykfllshgfvmdgegkkmsksl
    gnvivpdqvvkqkgadiarlwvsstdyladvrisdeilkqtsddyrkirntlrfmlgnin
    dfnpdtdsipesellevdryllnrlreftastinnyenfdylniyqevqnfinvelsnfy
    ldygkdilyieqrdshirrsmqtvlyqilvdmtkllapilvhtaeevwshtphvkeesvh
    ladmpkvvevdqalldkwrtfmnlrddvnraletarnekvigksleakvtiasndkfnas
    efltsfdalhqlfivsqvkvvdklddqatayehgdiviehadgekcercwnysedlgavd
    elthlcprcqqvvkslv
    

  • Chain 'T':
    No sequence available.