PDB entry 1qu1

View 1qu1 on RCSB PDB site
Description: crystal structure of eha2 (23-185)
Class: Viral protein
Keywords: hemagglutinin, low-ph, virus/viral protein
Deposited on 1999-07-05, released 2000-01-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.229
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (influenza recombinant ha2 chain)
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437
      • conflict (106)
    Domains in SCOPe 2.06: d1qu1a_
  • Chain 'B':
    Compound: protein (influenza recombinant ha2 chain)
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437
      • conflict (106)
    Domains in SCOPe 2.06: d1qu1b_
  • Chain 'C':
    Compound: protein (influenza recombinant ha2 chain)
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437 (Start-154)
      • conflict (106)
    Domains in SCOPe 2.06: d1qu1c_
  • Chain 'D':
    Compound: protein (influenza recombinant ha2 chain)
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437
      • conflict (106)
    Domains in SCOPe 2.06: d1qu1d_
  • Chain 'E':
    Compound: protein (influenza recombinant ha2 chain)
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437
      • conflict (106)
    Domains in SCOPe 2.06: d1qu1e_
  • Chain 'F':
    Compound: protein (influenza recombinant ha2 chain)
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437 (0-154)
      • conflict (106)
    Domains in SCOPe 2.06: d1qu1f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qu1A (A:)
    gtgqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkid
    lwsynaellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnacie
    sirngtydhdvyrdealnnrfqikgvelksgykdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu1A (A:)
    qaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlws
    ynaellvalenqhtidltdsemnklfektrrqlgsfkiyhkcdnaciesirngtydhdvy
    rdealnnrfqikg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qu1B (B:)
    gtgqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkid
    lwsynaellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnacie
    sirngtydhdvyrdealnnrfqikgvelksgykdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu1B (B:)
    gqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlw
    synaellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnaciesi
    rngtydhdvyrdealnnrfqikgv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qu1C (C:)
    gtgqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkid
    lwsynaellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnacie
    sirngtydhdvyrdealnnrfqikgvelksgykdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu1C (C:)
    adlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsyn
    aellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnaciesirng
    tydhdvyrdealnnrfqikgvelksgykdw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qu1D (D:)
    gtgqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkid
    lwsynaellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnacie
    sirngtydhdvyrdealnnrfqikgvelksgykdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu1D (D:)
    gqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlw
    synaellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnaciesi
    rngtydhdvyrdealnnrfqikgvel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qu1E (E:)
    gtgqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkid
    lwsynaellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnacie
    sirngtydhdvyrdealnnrfqikgvelksgykdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu1E (E:)
    gqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlw
    synaellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnaciesi
    rngtydhdvyrdealnnrfqikgvel
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qu1F (F:)
    gtgqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkid
    lwsynaellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnacie
    sirngtydhdvyrdealnnrfqikgvelksgykdw