PDB entry 1qu0

View 1qu0 on RCSB PDB site
Description: crystal structure of the fifth laminin g-like module of the mouse laminin alpha2 chain
Class: metal binding protein
Keywords: beta sandwich, calcium-binding protein, metal binding protein
Deposited on 1999-07-05, released 1999-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.229
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: laminin alpha2 chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qu0a_
  • Chain 'B':
    Compound: laminin alpha2 chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qu0b_
  • Chain 'C':
    Compound: laminin alpha2 chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qu0c_
  • Chain 'D':
    Compound: laminin alpha2 chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qu0d_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qu0A (A:)
    aplaanaesgtyfdgtgfakavggfkvgldllvefefrttrptgvllgissqkmdgmgie
    mideklmfhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqsp
    nsastsadtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalel
    rgvqpvscptt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu0A (A:)
    sgtyfdgtgfakavggfkvgldllvefefrttrptgvllgissqkmdgmgiemideklmf
    hvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsastsad
    tndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqpvsc
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qu0B (B:)
    aplaanaesgtyfdgtgfakavggfkvgldllvefefrttrptgvllgissqkmdgmgie
    mideklmfhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqsp
    nsastsadtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalel
    rgvqpvscptt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu0B (B:)
    sgtyfdgtgfakavggfkvgldllvefefrttrptgvllgissqkmdgmgiemideklmf
    hvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsastsad
    tndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqpvsc
    p
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qu0C (C:)
    aplaanaesgtyfdgtgfakavggfkvgldllvefefrttrptgvllgissqkmdgmgie
    mideklmfhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqsp
    nsastsadtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalel
    rgvqpvscptt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu0C (C:)
    esgtyfdgtgfakavggfkvgldllvefefrttrptgvllgissqkmdgmgiemideklm
    fhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsastsa
    dtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqpvs
    cpt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qu0D (D:)
    aplaanaesgtyfdgtgfakavggfkvgldllvefefrttrptgvllgissqkmdgmgie
    mideklmfhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqsp
    nsastsadtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalel
    rgvqpvscptt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qu0D (D:)
    sgtyfdgtgfakavggfkvgldllvefefrttrptgvllgissqkmdgmgiemideklmf
    hvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsastsad
    tndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqpvsc
    p