PDB entry 1qty

View 1qty on RCSB PDB site
Description:
Deposited on 1999-06-29, released 2000-01-12
The last revision prior to the SCOP 1.57 freeze date was dated 2000-04-19, with a file datestamp of 2000-04-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1qtyr_
  • Chain 'S':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1qtys_
  • Chain 'T':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1qtyt_
  • Chain 'U':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1qtyu_
  • Chain 'V':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1qtyv_
  • Chain 'W':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1qtyw_
  • Chain 'X':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1qtyx_
  • Chain 'Y':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1qtyy_

PDB Chain Sequences:

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qtyR (R:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qtyS (S:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkk
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qtyT (T:)
    grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
    fiisnatykeiglltceatvnghlyktnylthrq
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qtyU (U:)
    grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
    fiisnatykeiglltceatvnghlyktnylthrq
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qtyV (V:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpk
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qtyW (W:)
    evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpk
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qtyX (X:)
    grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
    fiisnatykeiglltceatvnghlyktnylthrq
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qtyY (Y:)
    grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
    fiisnatykeiglltceatvnghlyktnylthrq