PDB entry 1qtw

View 1qtw on RCSB PDB site
Description: high-resolution crystal structure of the escherichia coli DNA repair enzyme endonuclease IV
Class: hydrolase
Keywords: DNA repair enzyme, tim barrel, trinuclear zn cluster, hydrolase
Deposited on 1999-06-29, released 1999-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: N/A
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endonuclease IV
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qtwa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qtwA (A:)
mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
ytsaqilphdsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
hdafrwimqddrfdgipliletinpdiwaeeiawlkaqqtekava