PDB entry 1qtq

View 1qtq on RCSB PDB site
Description: glutaminyl-trna synthetase complexed with trna and an amino acid analog
Deposited on 1998-01-28, released 1998-05-27
The last revision prior to the SCOP 1.55 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.244
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qtqA (A:)
    tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
    tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
    qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
    pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
    tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
    efckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqgegemvtmpn
    hpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvikaervekdae
    gnittifctydadtlskdpadgrkvkgvihwvsaahalpveirlydrlfsvpnpgaaddf
    lsvinpeslvikqgfaepslkdavagkafqferegyfcldsrhstaekpvfnrtvglrdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qtqA (A:)
    tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
    tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
    qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
    pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
    tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
    efckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqgegemvtmpn
    hpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvikaervekdae
    gnittifctydadtlgvihwvsaahalpveirlydrlfsvpnpgaaddflsvinpeslvi
    kqgfaepslkdavagkafqferegyfcldsrhstaekpvfnrtvglrdt