PDB entry 1qtq

View 1qtq on RCSB PDB site
Description: glutaminyl-tRNA synthetase complexed with tRNA and an amino acid analog
Class: ligase/RNA
Keywords: tRNA synthetase, glutamine, trnagln, e. coli, complex, ligase/RNA complex
Deposited on 1998-01-28, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.244
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glutaminyl-tRNA synthetase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qtqa1, d1qtqa2
  • Chain 'B':
    Compound: RNA (tRNA gln II )
    Species: Escherichia coli [TaxId:562]
  • Heterogens: SO4, QSI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qtqA (A:)
    seaearptnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgq
    cnlrfddtnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglay
    vdeltpeqireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmas
    pfivmrdpvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrly
    dwvldnitipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrg
    ytaasirefckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqgeg
    emvtmpnhpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvikae
    rvekdaegnittifctydadtlskdpadgrkvkgvihwvsaahalpveirlydrlfsvpn
    pgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsrhstaekpvfnr
    tvglrdtwakvge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qtqA (A:)
    tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
    tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
    qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
    pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
    tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
    efckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqgegemvtmpn
    hpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvikaervekdae
    gnittifctydadtlgvihwvsaahalpveirlydrlfsvpnpgaaddflsvinpeslvi
    kqgfaepslkdavagkafqferegyfcldsrhstaekpvfnrtvglrdt
    

  • Chain 'B':
    No sequence available.