PDB entry 1qtp

View 1qtp on RCSB PDB site
Description: crystal structure of the ap-2 clathrin adaptor alpha-appendage
Deposited on 1999-06-28, released 1999-07-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-23, with a file datestamp of 2000-06-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.168
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qtpA (A:)
    gspgirlgssednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfln
    ftptlicaddlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtf
    qnvsvklpitlnkffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiig
    fgsalleevdpnpanfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlc
    ellseqf