PDB entry 1qtp

View 1qtp on RCSB PDB site
Description: crystal structure of the ap-2 clathrin adaptor alpha-appendage
Class: membrane protein
Keywords: four-wavelength mad, selenomethionine, membrane protein
Deposited on 1999-06-28, released 1999-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.168
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ap-2 clathrin adaptor alpha subunit (alpha-adaptin c)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17427 (0-246)
      • conflict (0-8)
      • modified (45)
      • modified (139)
      • modified (168)
      • modified (222)
    Domains in SCOPe 2.08: d1qtpa1, d1qtpa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qtpA (A:)
gspgirlgssednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfln
ftptlicaddlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtf
qnvsvklpitlnkffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiig
fgsalleevdpnpanfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlc
ellseqf