PDB entry 1qto

View 1qto on RCSB PDB site
Description: 1.5 a crystal structure of a bleomycin resistance determinant from bleomycin-producing streptomyces verticillus
Deposited on 1999-06-28, released 2000-06-28
The last revision prior to the SCOP 1.69 freeze date was dated 2000-06-28, with a file datestamp of 2000-06-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.19
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1qtoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qtoA (A:)
    mvkflgavpvltavdvpanvsfwvdtlgfekdfgdrdfagvrrgdirlhisrtehqivad
    ntsawievtdpdalheewaravstdyadtsgpamtpvgespagrefavrdpagncvhfta
    ge