PDB entry 1qtn

View 1qtn on RCSB PDB site
Description: crystal structure of the complex of caspase-8 with the tetrapeptide inhibitor ace-ietd-aldehyde
Class: hydrolase/hydrolase inhibitor
Keywords: apoptosis, dithiane-diol, caspase, cysteine-protease, hydrolase-hydrolase inhibitor complex
Deposited on 1999-06-28, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.166
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caspase-8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qtn.1
  • Chain 'B':
    Compound: caspase-8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qtn.1
  • Chain 'C':
    Compound: acetyl-ile-glu-thr-asp-aldehyde
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1QTN (Start-3)
  • Heterogens: DTD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qtnA (A:)
    spreqdsesqtldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagal
    tttfeelhfeikphddctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqe
    apiyeltsqftglkcpslagkpkvffiqacqgdnyqkgipvetd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qtnA (A:)
    dkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfeik
    phddctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqftg
    lkcpslagkpkvffiqacqgdnyqkgipvetd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qtnB (B:)
    lsspqtryipdeadfllgmatvnncvsyrnpaegtwyiqslcqslrercprgddiltilt
    evnyevsnkddkknmgkqmpqptftlrkklvfpsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qtnB (B:)
    tryipdeadfllgmatvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnye
    vsnkddkknmgkqmpqptftlrkklvfpsd
    

  • Chain 'C':
    No sequence available.