PDB entry 1qth

View 1qth on RCSB PDB site
Description: the introduction of strain and its effects on the structure and stability of t4 lysozyme
Class: hydrolase
Keywords: strain, stability, mutant, t4 lysozyme, hydrolase
Deposited on 1999-06-28, released 1999-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • engineered (53)
      • engineered (96-97)
    Domains in SCOPe 2.06: d1qtha_
  • Chain 'B':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • engineered (53)
      • engineered (96-97)
    Domains in SCOPe 2.06: d1qthb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qthA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrramlinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qthA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrramlinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qthB (B:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrramlinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qthB (B:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrramlinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk