PDB entry 1qtf

View 1qtf on RCSB PDB site
Description: crystal structure of exfoliative toxin b
Deposited on 1999-06-27, released 1999-08-31
The last revision prior to the SCOP 1.59 freeze date was dated 1999-08-31, with a file datestamp of 1999-08-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.204
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1qtfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qtfA (A:)
    keysaeeirklkqkfevpptdkelythitdnarspynsvgtvfvkgstlatgvligknti
    vtnyhvareaaknpsniiftpaqnrdaeknefptpygkfeaeeikespygqgldlaiikl
    kpnekgesagdliqpanipdhidiakgdkysllgypynysayslyqsqiemfndsqyfgy
    tevgnsgsgifnlkgeligihsgkggqhnlpigvffnrkisslysvdntfgdtlgndlkk
    rakldk