PDB entry 1qte

View 1qte on RCSB PDB site
Description: crystal structure of the 70 kda soluble lytic transglycosylase slt70 from escherichia coli at 1.90 a resolution in complex with a 1,6-anhydromurotripeptide
Class: hydrolase
Keywords: alpha-superhelix, hydrolase
Deposited on 1999-06-27, released 1999-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: soluble lytic transglycosylase slt70
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PIR S56616 (0-617)
    Domains in SCOPe 2.07: d1qtea1, d1qtea2
  • Heterogens: NAG, SO4, ACT, ALA, AH0, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qteA (A:)
    dsldeqrsryaqikqawdnrqmdvveqmmpglkdyplypyleyrqitddlmnqpavtvtn
    fvranptlppartlqsrfvnelarredwrgllafspekpgtteaqcnyyyakwntgqsee
    awqgakelwltgksqpnacdklfsvwrasgkqdplaylerirlamkagntglvtvlagqm
    padyqtiasaiislannpntvltfarttgatdftrqmaavafasvarqdaenarlmipsl
    aqaqqlnedqiqelrdivawrlmgndvtdeqakwrddaimrsqstslierrvrmalgtgd
    rrglntwlarlpmeakekdewrywqadlllergreaeakeilhqlmqqrgfypmvaaqri
    geeyelkidkapqnvdsaltqgpemarvrelmywnldntarsewanlvkskskteqaqla
    ryafnnqwwdlsvqatiagklwdhleerfplayndlfkrytsgkeipqsyamaiarqesa
    wnpkvkspvgasglmqimpgtathtvkmfsipgysspgqlldpetninigtsylqyvyqq
    fgnnrifssaaynagpgrvrtwlgnsagridavafvesipfsetrgyvknvlaydayyry
    fmgdkptlmsatewgrry