PDB entry 1qtc

View 1qtc on RCSB PDB site
Description: the introduction of strain and its effects on the structure and stability of t4 lysozyme
Deposited on 1999-06-26, released 1999-07-22
The last revision prior to the SCOP 1.71 freeze date was dated 2000-01-26, with a file datestamp of 2000-01-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1qtca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qtcA (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdefavnlaksrwynqtpnrakrvittfrtgtwdayk